PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1782.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 297aa    MW: 33516.7 Da    PI: 8.1541
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1782.2genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.95e-14226269548
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                                   +r++r++kNRe+A rsR+RK+a++ +Le++v  L + N+ Lkk+
  evm.model.supercontig_1782.2 226 RRQKRMIKNRESAARSRARKQAYTNHLENEVFHLRKTNSWLKKQ 269
                                   69*************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-9222290IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.818224269IPR004827Basic-leucine zipper domain
PfamPF001701.3E-11226269IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-12226270No hitNo description
SuperFamilySSF579592.25E-10226271No hitNo description
CDDcd147072.31E-22226271No hitNo description
PROSITE patternPS000360229244IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MVSSPNRPEE QEFQSQKSQG SVYTLAIDEV QTLCKKSSSS SSSSSSFSHP LILGNLNLHG  60
TLCKKTVDEV WRDIVHCDHG NDGVQTQQIQ RQLPLGETRI EDFLARAGII NIGNTHRSNL  120
IDHQPLMSVD PMVIMSHQHA DWLQFQMSSF QQQQQQNLTM VDSSFCVSES MCENPVVDCG  180
YGETQLGVTA IPPLQAMVAT PAESQGGGEQ RKRRYTDEMM EKTIERRQKR MIKNRESAAR  240
SRARKQAYTN HLENEVFHLR KTNSWLKKQK EAEVMLSTVP VSGSKYQLRR TSSAQF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015887632.11e-91PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLB9RJD43e-86B9RJD4_RICCO; DNA binding protein, putative
STRINGPOPTR_0002s09140.12e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17216911
Representative plantOGRP1630733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-36ABA-responsive element binding protein 3